UGT8 antibody (Middle Region)

Catalog No. ABIN635705

Product Details anti-UGT8 Antibody

Target: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT8 antibody was raised against the middle region of µgT8

Purification: Affinity purified

Immunogen: UGT8 antibody was raised using the middle region of µgT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT8 Blocking Peptide, catalog no. 33R-3336, is also available for use as a blocking control in assays to test for specificity of this µgT8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT8

Target: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Alternative Name: UGT8 (UGT8 Products)

Synonyms: Xlcgt antibody, cgt antibody, ugt4 antibody, AI850488 antibody, AW455908 antibody, Cgt antibody, Ugt8 antibody, mCerGT antibody, CGT antibody, UGT4 antibody, Ugt8a antibody, UDP glycosyltransferase 8 antibody, UDP galactosyltransferase 8A antibody, UGT8 antibody, ugt8 antibody, Ugt8a antibody, Ugt8 antibody

Background: Galactocerebrosides are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system and are also present in small amounts in kidney. The key enzymatic step in the biosynthesis of galactocerebrosides consists of the transfer of galactose to ceramide catalyzed by UDP-galactose ceramide galactosyltransferase. The enzyme UGT8 is the first involved in complex lipid biosynthesis in the myelinating oligodendrocyte.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization