UGT8 antibody (Middle Region)

Catalog No. ABIN635705

The Rabbit Polyclonal anti-UGT8 antibody is suitable to detect UGT8 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for UGT8 antibody (Middle Region) (ABIN635705)

Target: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UGT8 Antibody

Binding Specificity: Middle Region

Specificity: UGT8 antibody was raised against the middle region of µgT8

Purification: Affinity purified

Immunogen: UGT8 antibody was raised using the middle region of µgT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT8 Blocking Peptide, (ABIN938722), is also available for use as a blocking control in assays to test for specificity of this µgT8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT8

Target: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Alternative Name: UGT8

Background: Galactocerebrosides are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system and are also present in small amounts in kidney. The key enzymatic step in the biosynthesis of galactocerebrosides consists of the transfer of galactose to ceramide catalyzed by UDP-galactose ceramide galactosyltransferase. The enzyme UGT8 is the first involved in complex lipid biosynthesis in the myelinating oligodendrocyte.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization