Unc5c antibody

Catalog No. ABIN635708

The Rabbit Polyclonal anti-Unc5c antibody is suitable to detect Unc5c in samples from Human. It has been validated for WB.

Quick Overview for Unc5c antibody (ABIN635708)

Target: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Unc5c antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Unc5c Antibody

Purification: Affinity purified

Immunogen: UNC5 C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC5C Blocking Peptide, (ABIN5616912), is also available for use as a blocking control in assays to test for specificity of this UNC5C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Unc5c

Target: Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))

Alternative Name: UNC5C

Background: UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Molecular Weight: 103 kDa (MW of target protein)