FGG antibody (Middle Region)
-
- Target See all FGG Antibodies
- FGG (Fibrinogen gamma Chain (FGG))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FGG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FGG antibody was raised against the middle region of FGG
- Purification
- Affinity purified
- Immunogen
- FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ
- Top Product
- Discover our top product FGG Primary Antibody
-
anti-Fibrinogen gamma Chain (FGG) antibody
FGG Reactivity: Human IHC, ELISA, ICC, FACS Host: Mouse Monoclonal 4H9 unconjugated
anti-Fibrinogen gamma Chain (FGG) (AA 166-416) antibodyFGG Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Fibrinogen gamma Chain (FGG) (AA 168-405) antibodyFGG Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Fibrinogen gamma Chain (FGG) (AA 31-130) antibodyFGG Reactivity: Human WB, ELISA, IHC (p), PLA Host: Mouse Monoclonal 1F2 unconjugated
anti-Fibrinogen gamma Chain (FGG) antibodyFGG Reactivity: Human WB, IP, ICC, IF, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Fibrinogen gamma Chain (FGG) (AA 420-449), (C-Term) antibodyFGG Reactivity: Human WB, IF, IHC (p) Host: Rabbit Polyclonal RB19515 unconjugated
anti-Fibrinogen gamma Chain (FGG) antibodyFGG Reactivity: Human ELISA, ICC Host: Mouse Monoclonal 5A6 unconjugated
anti-Fibrinogen gamma Chain (FGG) (AA 278-437) antibodyFGG Reactivity: Human WB, IHC, ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-Fibrinogen gamma Chain (FGG) (AA 151-250) antibodyFGG Reactivity: Human, Mouse, Rat WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Fibrinogen gamma Chain (FGG) (AA 417-445), (C-Term) antibodyFGG Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB18714 unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FGG Blocking Peptide, catalog no. 33R-3672, is also available for use as a blocking control in assays to test for specificity of this FGG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGG (Fibrinogen gamma Chain (FGG))
- Alternative Name
- FGG (FGG Products)
- Background
- FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.
- Molecular Weight
- 46 kDa (MW of target protein)
-
