SLC39A5 antibody

Catalog No. ABIN635718

This anti-SLC39A5 antibody is a Rabbit Polyclonal antibody detecting SLC39A5 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SLC39A5 antibody (ABIN635718)

Target: SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC39A5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC39A5 Antibody

Purification: Affinity purified

Immunogen: SLC39 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A5 Blocking Peptide, (ABIN939263), is also available for use as a blocking control in assays to test for specificity of this SLC39A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC39A5

Target: SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))

Alternative Name: SLC39A5

Background: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis