SLC45A3 antibody (Middle Region)

Catalog No. ABIN635719

This Rabbit Polyclonal antibody specifically detects SLC45A3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SLC45A3 antibody (Middle Region) (ABIN635719)

Target: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC45A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC45A3 Antibody

Binding Specificity: Middle Region

Specificity: SLC45 A3 antibody was raised against the middle region of SLC45 3

Purification: Affinity purified

Immunogen: SLC45 A3 antibody was raised using the middle region of SLC45 3 corresponding to a region with amino acids LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC45A3 Blocking Peptide, (ABIN940344), is also available for use as a blocking control in assays to test for specificity of this SLC45A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC45A3

Target: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Alternative Name: SLC45A3

Background: SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.

Molecular Weight: 59 kDa (MW of target protein)