GAA antibody (N-Term)
-
- Target See all GAA Antibodies
- GAA (Glucosidase, Alpha, Acid (GAA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GAA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GAA antibody was raised against the N terminal of GAA
- Purification
- Affinity purified
- Immunogen
- GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
- Top Product
- Discover our top product GAA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GAA Blocking Peptide, catalog no. 33R-2917, is also available for use as a blocking control in assays to test for specificity of this GAA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAA (Glucosidase, Alpha, Acid (GAA))
- Alternative Name
- GAA (GAA Products)
- Background
- GAA is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum.
- Molecular Weight
- 98 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-