ACSL4 antibody (N-Term)

Catalog No. ABIN635728

Product Details anti-ACSL4 Antibody

Target: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACSL4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACSL4 antibody was raised against the N terminal of ACSL4

Purification: Affinity purified

Immunogen: ACSL4 antibody was raised using the N terminal of ACSL4 corresponding to a region with amino acids AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACSL4 Blocking Peptide, catalog no. 33R-1307, is also available for use as a blocking control in assays to test for specificity of this ACSL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACSL4

Target: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Alternative Name: ACSL4 (ACSL4 Products)

Synonyms: acsl4 antibody, zgc:66186 antibody, ACSL4 antibody, ACS4 antibody, FACL4 antibody, LACS4 antibody, MRX63 antibody, MRX68 antibody, 9430020A05Rik antibody, AU018108 antibody, Facl4 antibody, Lacs4 antibody, Acs4 antibody, acs4 antibody, acsl3 antibody, facl4 antibody, lacs4 antibody, mrx63 antibody, mrx68 antibody, T32A16.20 antibody, T32A16_20 antibody, long-chain acyl-CoA synthetase 4 antibody, acyl-CoA synthetase long chain family member 4a antibody, acyl-CoA synthetase long-chain family member 4 antibody, acyl-CoA synthetase long chain family member 4 antibody, AcsL4 antibody, acyl-CoA synthetase long chain family member 3 antibody, Long-chain-fatty-acid--CoA ligase 4 antibody, acyl-CoA synthetase long-chain family member 4 S homeolog antibody, AMP-dependent synthetase and ligase family protein antibody, acsl4a antibody, ACSL4 antibody, acsL4 antibody, acsl3 antibody, acsl4 antibody, Acsl4 antibody, acsl4.S antibody, LACS4 antibody

Background: ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.

Molecular Weight: 74 kDa (MW of target protein)