GALC antibody (Middle Region)

Catalog No. ABIN635737

This Rabbit Polyclonal antibody specifically detects GALC in WB. It exhibits reactivity toward Human, Rat, Mouse and Dog.

Quick Overview for GALC antibody (Middle Region) (ABIN635737)

Target: GALC (Galactosylceramidase (GALC))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GALC Antibody

Binding Specificity: Middle Region

Specificity: GALC antibody was raised against the middle region of GALC

Purification: Affinity purified

Immunogen: GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALC Blocking Peptide, (ABIN5613708), is also available for use as a blocking control in assays to test for specificity of this GALC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALC

Target: GALC (Galactosylceramidase (GALC))

Alternative Name: GALC

Background: GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.

Molecular Weight: 73 kDa (MW of target protein)