XYLT2 antibody (Middle Region)

Catalog No. ABIN635743

This Rabbit Polyclonal antibody specifically detects XYLT2 in WB. It exhibits reactivity toward Mouse, Human, Dog and Rat.

Quick Overview for XYLT2 antibody (Middle Region) (ABIN635743)

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Reactivity: Mouse, Human, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XYLT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-XYLT2 Antibody

Binding Specificity: Middle Region

Specificity: XYLT2 antibody was raised against the middle region of XYLT2

Purification: Affinity purified

Immunogen: XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XYLT2 Blocking Peptide, (ABIN5617052), is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XYLT2

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Alternative Name: XYLT2

Background: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process