XYLT2 antibody (C-Term)

Catalog No. ABIN635768

Product Details anti-XYLT2 Antibody

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Binding Specificity: C-Term

Reactivity: Mouse, Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XYLT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: XYLT2 antibody was raised against the C terminal of XYLT2

Purification: Affinity purified

Immunogen: XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XYLT2 Blocking Peptide, catalog no. 33R-5377, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XYLT2

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Alternative Name: XYLT2 (XYLT2 Products)

Synonyms: MGC89331 antibody, PXYLT2 antibody, XT-II antibody, XT2 antibody, xylT-II antibody, xt-II antibody, E030002B02Rik antibody, xylt-II antibody, xylosyltransferase II antibody, xylosyltransferase 2 antibody, xylt2 antibody, XYLT2 antibody, Xylt2 antibody

Background: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process