LIM2 antibody (N-Term)

Catalog No. ABIN635747

The Rabbit Polyclonal anti-LIM2 antibody has been validated for WB. It is suitable to detect LIM2 in samples from Human.

Quick Overview for LIM2 antibody (N-Term) (ABIN635747)

Target: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LIM2 Antibody

Binding Specificity: N-Term

Specificity: LIM2 antibody was raised against the N terminal of LIM2

Purification: Affinity purified

Immunogen: LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIM2 Blocking Peptide, (ABIN938945), is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIM2

Target: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Alternative Name: LIM2

Background: This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization