Tetraspanin 3 antibody (Middle Region)

Catalog No. ABIN635759

Product Details anti-Tetraspanin 3 Antibody

Target: Tetraspanin 3 (TSPAN3)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 3 antibody was raised against the middle region of TSPAN3

Purification: Affinity purified

Immunogen: Tetraspanin 3 antibody was raised using the middle region of TSPAN3 corresponding to a region with amino acids SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 3 Blocking Peptide, catalog no. 33R-8740, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 3

Target: Tetraspanin 3 (TSPAN3)

Alternative Name: Tetraspanin 3 (TSPAN3 Products)

Synonyms: tm4-a antibody, tm4sf8 antibody, tspan-3 antibody, fj34d08 antibody, si:dkey-24l11.4 antibody, wu:fj34d08 antibody, zgc:114050 antibody, DKFZp469M0635 antibody, TM4-A antibody, TM4SF8 antibody, TSPAN-3 antibody, 1700055K04Rik antibody, Tm4sf8 antibody, tetraspanin 3 antibody, tetraspanin 3a antibody, tetraspanin 3 S homeolog antibody, TSPAN3 antibody, tspan3 antibody, tspan3a antibody, tspan3.S antibody, Tspan3 antibody

Background: TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molecular Weight: 25 kDa (MW of target protein)