TMTC1 antibody (Middle Region)

Catalog No. ABIN635781

Product Details anti-TMTC1 Antibody

Target: TMTC1 (Transmembrane and Tetratricopeptide Repeat Containing 1 (TMTC1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMTC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMTC1 antibody was raised against the middle region of TMTC1

Purification: Affinity purified

Immunogen: TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMTC1 Blocking Peptide, catalog no. 33R-4937, is also available for use as a blocking control in assays to test for specificity of this TMTC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMTC1

Target: TMTC1 (Transmembrane and Tetratricopeptide Repeat Containing 1 (TMTC1))

Alternative Name: TMTC1 (TMTC1 Products)

Synonyms: OLF antibody, TMTC1A antibody, Arg99 antibody, BC023818 antibody, RGD1564868 antibody, transmembrane and tetratricopeptide repeat containing 1 antibody, TMTC1 antibody, Tmtc1 antibody

Background: TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.

Molecular Weight: 87 kDa (MW of target protein)