FOLR1 antibody

Catalog No. ABIN635782

Product Details anti-FOLR1 Antibody

Target: FOLR1 (Folate Receptor 1 (Adult) (FOLR1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FOLR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FOLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FOLR1 Blocking Peptide, catalog no. 33R-3731, is also available for use as a blocking control in assays to test for specificity of this FOLR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FOLR1

Target: FOLR1 (Folate Receptor 1 (Adult) (FOLR1))

Alternative Name: FOLR1 (FOLR1 Products)

Synonyms: FBP antibody, FOLR antibody, fbp antibody, folr antibody, folr1 antibody, FBP1 antibody, Folbp-1 antibody, Folbp1 antibody, Fbp1 antibody, FOLR1 antibody, Folr1 antibody, folate receptor 1 antibody, folate receptor 1 (adult) antibody, folate receptor 1 (adult) L homeolog antibody, zgc:165502 antibody, Folate receptor alpha antibody, folate receptor alpha antibody, FOLR1 antibody, folr1 antibody, folr1.L antibody, zgc:165502 antibody, Folr1 antibody, LOC100066084 antibody, LOC100725439 antibody

Background: The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport