ADAM7 antibody (C-Term)

Catalog No. ABIN635785

This Rabbit Polyclonal antibody specifically detects ADAM7 in WB. It exhibits reactivity toward Human.

Quick Overview for ADAM7 antibody (C-Term) (ABIN635785)

Target: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM7 Antibody

Binding Specificity: C-Term

Specificity: ADAM7 antibody was raised against the C terminal of ADAM7

Purification: Affinity purified

Immunogen: ADAM7 antibody was raised using the C terminal of ADAM7 corresponding to a region with amino acids PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM7 Blocking Peptide, (ABIN5611937), is also available for use as a blocking control in assays to test for specificity of this ADAM7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM7

Target: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Alternative Name: ADAM7

Background: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.

Molecular Weight: 83 kDa (MW of target protein)

Pathways: Notch Signaling