IL11RA antibody (Middle Region)

Catalog No. ABIN635795

Product Details anti-IL11RA Antibody

Target: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL11RA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL11 R alpha antibody was raised against the middle region of IL11 A

Purification: Affinity purified

Immunogen: IL11 R alpha antibody was raised using the middle region of IL11 A corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL11R alpha Blocking Peptide, catalog no. 33R-2968, is also available for use as a blocking control in assays to test for specificity of this IL11R alpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL11RA

Target: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Alternative Name: IL11R alpha (IL11RA Products)

Synonyms: CRSDA antibody, fi26e06 antibody, il-11ra antibody, wu:fi26e06 antibody, AI314697 antibody, GP130 antibody, Il-11ra antibody, Il11ra antibody, Il11ra2 antibody, NR1 antibody, interleukin 11 receptor subunit alpha antibody, interleukin 11 receptor, alpha antibody, interleukin 11 receptor subunit alpha 1 antibody, interleukin 11 receptor, alpha chain 1 antibody, IL11RA antibody, il11ra antibody, Il11ra1 antibody, Il11ra antibody

Background: Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Growth Factor Binding