FKBP11 antibody (N-Term)

Catalog No. ABIN635804

The Rabbit Polyclonal anti-FKBP11 antibody is suitable to detect FKBP11 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for FKBP11 antibody (N-Term) (ABIN635804)

Target: FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBP11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FKBP11 Antibody

Binding Specificity: N-Term

Specificity: FKBP11 antibody was raised against the N terminal of FKBP11

Purification: Affinity purified

Immunogen: FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBP11 Blocking Peptide, (ABIN5613593), is also available for use as a blocking control in assays to test for specificity of this FKBP11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBP11

Target: FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))

Alternative Name: FKBP11

Background: FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin.

Molecular Weight: 19 kDa (MW of target protein)