BTN1A1 antibody (N-Term)

Catalog No. ABIN635808

Product Details anti-BTN1A1 Antibody

Target: BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTN1A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BTN1 A1 antibody was raised against the N terminal of BTN1 1

Purification: Affinity purified

Immunogen: BTN1 A1 antibody was raised using the N terminal of BTN1 1 corresponding to a region with amino acids LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTN1A1 Blocking Peptide, catalog no. 33R-5259, is also available for use as a blocking control in assays to test for specificity of this BTN1A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTN1A1

Target: BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))

Alternative Name: BTN1A1 (BTN1A1 Products)

Synonyms: BT antibody, BTN antibody, Btn antibody, BTN1A1 antibody, TVC antibody, butyrophilin subfamily 1 member A1 antibody, butyrophilin, subfamily 1, member A1 antibody, zgc:162154 antibody, BTN1A1 antibody, Btn1a1 antibody, btn1a1 antibody, zgc:162154 antibody

Background: Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Activated T Cell Proliferation