PTGIS antibody

Catalog No. ABIN635828

The Rabbit Polyclonal anti-PTGIS antibody has been validated for WB. It is suitable to detect PTGIS in samples from Human, Mouse and Rat.

Quick Overview for PTGIS antibody (ABIN635828)

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGIS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PTGIS Antibody

Purification: Affinity purified

Immunogen: PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTGIS Blocking Peptide, (ABIN937879), is also available for use as a blocking control in assays to test for specificity of this PTGIS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGIS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTGIS

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Alternative Name: PTGIS

Background: PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.

Molecular Weight: 57 kDa (MW of target protein)