PTGIS antibody
-
- Target See all PTGIS Antibodies
- PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTGIS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS
- Top Product
- Discover our top product PTGIS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTGIS Blocking Peptide, catalog no. 33R-2493, is also available for use as a blocking control in assays to test for specificity of this PTGIS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGIS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))
- Alternative Name
- PTGIS (PTGIS Products)
- Background
- PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.
- Molecular Weight
- 57 kDa (MW of target protein)
-