PTGIS antibody
-
- Target See all PTGIS Antibodies
- PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTGIS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS
- Top Product
- Discover our top product PTGIS Primary Antibody
-
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (Internal Region) antibody
PTGIS Reactivity: Human, Mouse, Rat WB, ELISA, IHC, ICC, IF Host: Rabbit Polyclonal unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 391-500) antibodyPTGIS Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 391-500) antibodyPTGIS Reactivity: Human WB, ELISA Host: Mouse Monoclonal 3B11 unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 30-61), (N-Term) antibodyPTGIS Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal RB17091 unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 472-500), (C-Term) antibodyPTGIS Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB17094 unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 1-500) antibodyPTGIS Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 475-490) antibodyPTGIS Reactivity: Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 299-329) antibodyPTGIS Reactivity: Cow WB, IHC (p), IP Host: Rabbit Polyclonal unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 1-500) antibodyPTGIS Reactivity: Human WB, IHC, ICC Host: Rabbit Polyclonal unconjugated
anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) antibodyPTGIS Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTGIS Blocking Peptide, catalog no. 33R-2493, is also available for use as a blocking control in assays to test for specificity of this PTGIS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGIS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))
- Alternative Name
- PTGIS (PTGIS Products)
- Synonyms
- CYP8 antibody, CYP8A1 antibody, PGIS antibody, PTGI antibody, Cyp8 antibody, Cyp8a1 antibody, Pgis antibody, ptgisl antibody, PTGIS antibody, prostaglandin I2 synthase antibody, prostaglandin I2 (prostacyclin) synthase antibody, prostacyclin synthase antibody, PTGIS antibody, Ptgis antibody, ptgis antibody, VDBG_06319 antibody
- Background
- PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.
- Molecular Weight
- 57 kDa (MW of target protein)
-
