CYP3A4 antibody (C-Term)

Catalog No. ABIN635831

The Rabbit Polyclonal anti-CYP3A4 antibody is suitable to detect CYP3A4 in samples from Human. It has been validated for WB.

Quick Overview for CYP3A4 antibody (C-Term) (ABIN635831)

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP3A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CYP3A4 Antibody

Binding Specificity: C-Term

Specificity: CYP3 A43 antibody was raised against the C terminal of CYP3 43

Purification: Affinity purified

Immunogen: CYP3 A43 antibody was raised using the C terminal of CYP3 43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP3A43 Blocking Peptide, (ABIN939603), is also available for use as a blocking control in assays to test for specificity of this CYP3A43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP3A4

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Alternative Name: CYP3A43

Background: CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis