SYVN1 antibody (C-Term)

Catalog No. ABIN635832

This anti-SYVN1 antibody is a Rabbit Polyclonal antibody detecting SYVN1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SYVN1 antibody (C-Term) (ABIN635832)

Target: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYVN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SYVN1 Antibody

Binding Specificity: C-Term

Specificity: SYVN1 antibody was raised against the C terminal of SYVN1

Purification: Affinity purified

Immunogen: SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SYVN1 Blocking Peptide, (ABIN936870), is also available for use as a blocking control in assays to test for specificity of this SYVN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYVN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYVN1

Target: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Alternative Name: SYVN1

Background: SYVN1 is a protein involved in endoplasmic reticulum (ER)-associated degradation. The protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Negative Regulation of intrinsic apoptotic Signaling