FZD7 antibody

Catalog No. ABIN635842

This Rabbit Polyclonal antibody specifically detects FZD7 in WB and IHC. It exhibits reactivity toward Human, Mouse and Dog.

Quick Overview for FZD7 antibody (ABIN635842)

Target: FZD7 (Frizzled Family Receptor 7 (FZD7))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-FZD7 Antibody

Purification: Affinity purified

Immunogen: FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD7 Blocking Peptide, (ABIN5613675), is also available for use as a blocking control in assays to test for specificity of this FZD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD7

Target: FZD7 (Frizzled Family Receptor 7 (FZD7))

Alternative Name: FZD7

Background: FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: WNT Signaling, Stem Cell Maintenance