LRRC15 antibody (N-Term)

Catalog No. ABIN635851

This Rabbit Polyclonal antibody specifically detects LRRC15 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for LRRC15 antibody (N-Term) (ABIN635851)

Target: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC15 Antibody

Binding Specificity: N-Term

Specificity: LRRC15 antibody was raised against the N terminal of LRRC15

Purification: Affinity purified

Immunogen: LRRC15 antibody was raised using the N terminal of LRRC15 corresponding to a region with amino acids LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC15 Blocking Peptide, (ABIN5614568), is also available for use as a blocking control in assays to test for specificity of this LRRC15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC15

Target: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Alternative Name: LRRC15

Background: LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

Molecular Weight: 64 kDa (MW of target protein)