SLITRK6 antibody (N-Term)

Catalog No. ABIN635857

Product Details anti-SLITRK6 Antibody

Target: SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLITRK6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLITRK6 antibody was raised against the N terminal of SLITRK6

Purification: Affinity purified

Immunogen: SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLITRK6 Blocking Peptide, catalog no. 33R-6684, is also available for use as a blocking control in assays to test for specificity of this SLITRK6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLITRK6

Target: SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))

Alternative Name: SLITRK6 (SLITRK6 Products)

Synonyms: 4832410J21Rik antibody, Sltk6 antibody, SLIT and NTRK like family member 6 antibody, SLIT and NTRK-like family, member 6 antibody, SLITRK6 antibody, slitrk6 antibody, Slitrk6 antibody

Background: Members of the SLITRK family, such as SLITRK6, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, including SLITRK6, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

Molecular Weight: 95 kDa (MW of target protein)