ADAM30 antibody (N-Term)

Catalog No. ABIN635861

The Rabbit Polyclonal anti-ADAM30 antibody is suitable to detect ADAM30 in samples from Human. It has been validated for WB.

Quick Overview for ADAM30 antibody (N-Term) (ABIN635861)

Target: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM30 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM30 Antibody

Binding Specificity: N-Term

Specificity: ADAM30 antibody was raised against the N terminal of ADAM30

Purification: Affinity purified

Immunogen: ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM30 Blocking Peptide, (ABIN939341), is also available for use as a blocking control in assays to test for specificity of this ADAM30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM30

Target: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Alternative Name: ADAM30

Background: ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins.

Molecular Weight: 66 kDa (MW of target protein)