PERP antibody (Middle Region)

Catalog No. ABIN635864

The Rabbit Polyclonal anti-PERP antibody has been validated for WB. It is suitable to detect PERP in samples from Human.

Quick Overview for PERP antibody (Middle Region) (ABIN635864)

Target: PERP (TP53 Apoptosis Effector (PERP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PERP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PERP Antibody

Binding Specificity: Middle Region

Specificity: PERP antibody was raised against the middle region of PERP

Purification: Affinity purified

Immunogen: PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PERP Blocking Peptide, (ABIN938370), is also available for use as a blocking control in assays to test for specificity of this PERP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PERP

Target: PERP (TP53 Apoptosis Effector (PERP))

Alternative Name: PERP

Background: PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Positive Regulation of Endopeptidase Activity