LMAN1 antibody (N-Term)

Catalog No. ABIN635868

This anti-LMAN1 antibody is a Rabbit Polyclonal antibody detecting LMAN1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for LMAN1 antibody (N-Term) (ABIN635868)

Target: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LMAN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LMAN1 Antibody

Binding Specificity: N-Term

Specificity: LMAN1 antibody was raised against the N terminal of LMAN1

Purification: Affinity purified

Immunogen: LMAN1 antibody was raised using the N terminal of LMAN1 corresponding to a region with amino acids DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LMAN1 Blocking Peptide, (ABIN937481), is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LMAN1

Target: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Alternative Name: LMAN1

Background: LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

Molecular Weight: 54 kDa (MW of target protein)