UGT1A7 antibody (N-Term)

Catalog No. ABIN635878

This Rabbit Polyclonal antibody specifically detects UGT1A7 in WB. It exhibits reactivity toward Human.

Quick Overview for UGT1A7 antibody (N-Term) (ABIN635878)

Target: UGT1A7 (UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT1A7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UGT1A7 Antibody

Binding Specificity: N-Term

Specificity: UGT1 A7 antibody was raised against the N terminal of µgT1 7

Purification: Affinity purified

Immunogen: UGT1 A7 antibody was raised using the N terminal of µgT1 7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT1A7 Blocking Peptide, (ABIN5616900), is also available for use as a blocking control in assays to test for specificity of this µgT1A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT1A7

Target: UGT1A7 (UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7))

Alternative Name: UGT1A7

Background: UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha