NHE7 antibody

Catalog No. ABIN635882

The Rabbit Polyclonal anti-NHE7 antibody is suitable to detect NHE7 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for NHE7 antibody (ABIN635882)

Target: NHE7 (SLC9A7) (Sodium Hydrogen Exchanger 7 (SLC9A7))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NHE7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NHE7 Antibody

Purification: Affinity purified

Immunogen: SLC9 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC9A7 Blocking Peptide, (ABIN940387), is also available for use as a blocking control in assays to test for specificity of this SLC9A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NHE7

Target: NHE7 (SLC9A7) (Sodium Hydrogen Exchanger 7 (SLC9A7))

Alternative Name: SLC9A7

Background: Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.

Molecular Weight: 80 kDa (MW of target protein)