PTGS1 antibody (Middle Region)
-
- Target See all PTGS1 Antibodies
- PTGS1 (Prostaglandin-Endoperoxide Synthase 1 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTGS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTGS1 antibody was raised against the middle region of PTGS1
- Purification
- Affinity purified
- Immunogen
- PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE
- Top Product
- Discover our top product PTGS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTGS1 Blocking Peptide, catalog no. 33R-3265, is also available for use as a blocking control in assays to test for specificity of this PTGS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGS1 (Prostaglandin-Endoperoxide Synthase 1 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS1))
- Alternative Name
- PTGS1 (PTGS1 Products)
- Background
- Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis.
- Molecular Weight
- 66 kDa (MW of target protein)
-