ANTXR1 antibody (Middle Region)

Catalog No. ABIN635911

Product Details anti-ANTXR1 Antibody

Target: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANTXR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANTXR1 antibody was raised against the middle region of ANTXR1

Purification: Affinity purified

Immunogen: ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANTXR1 Blocking Peptide, catalog no. 33R-9794, is also available for use as a blocking control in assays to test for specificity of this ANTXR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTXR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANTXR1

Target: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Alternative Name: ANTXR1 (ANTXR1 Products)

Synonyms: ANTXR1 antibody, ATR antibody, TEM8 antibody, 2310008J16Rik antibody, 2810405N18Rik antibody, Antrx1 antibody, Tem8 antibody, anthrax toxin receptor 1 antibody, ANTXR1 antibody, Antxr1 antibody

Background: ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.

Molecular Weight: 60 kDa (MW of target protein)