MTTP antibody (N-Term)

Catalog No. ABIN635912

Product Details anti-MTTP Antibody

Target: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTTP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MTTP antibody was raised against the N terminal of MTTP

Purification: Affinity purified

Immunogen: MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTTP Blocking Peptide, catalog no. 33R-6112, is also available for use as a blocking control in assays to test for specificity of this MTTP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTTP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTTP

Target: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Alternative Name: MTTP (MTTP Products)

Synonyms: ABL antibody, MTP antibody, 1810043K16Rik antibody, CG9342 antibody, CT3751 antibody, Dmel\\CG9342 antibody, dMTP antibody, wu:fd36b01 antibody, zgc:111876 antibody, microsomal triglyceride transfer protein antibody, Microsomal triacylglycerol transfer protein antibody, MTTP antibody, Mttp antibody, Mtp antibody, mttp antibody

Background: MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis