ALG6 antibody

Catalog No. ABIN635917

This Rabbit Polyclonal antibody specifically detects ALG6 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ALG6 antibody (ABIN635917)

Target: ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALG6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALG6 Antibody

Purification: Affinity purified

Immunogen: ALG6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALG6 Blocking Peptide, (ABIN5612020), is also available for use as a blocking control in assays to test for specificity of this ALG6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALG6

Target: ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))

Alternative Name: ALG6

Background: ALG6 is a member of the ALG6/ALG8 glucosyltransferase family. It catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene encoding ALG6 are associated with congenital disorders of glycosylation type Ic.

Molecular Weight: 58 kDa (MW of target protein)