Receptor Accessory Protein 4 antibody (N-Term)

Catalog No. ABIN635929

Product Details anti-Receptor Accessory Protein 4 Antibody

Target: Receptor Accessory Protein 4 (REEP4)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Receptor Accessory Protein 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: REEP4 antibody was raised against the N terminal of REEP4

Purification: Affinity purified

Immunogen: REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

REEP4 Blocking Peptide, catalog no. 33R-2476, is also available for use as a blocking control in assays to test for specificity of this REEP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Receptor Accessory Protein 4

Target: Receptor Accessory Protein 4 (REEP4)

Alternative Name: REEP4 (REEP4 Products)

Synonyms: C8orf20 antibody, 2700029E10Rik antibody, RGD1306561 antibody, receptor accessory protein 4 antibody, REEP4 antibody, Reep4 antibody

Background: REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.

Molecular Weight: 29 kDa (MW of target protein)