SLC39A12 antibody

Catalog No. ABIN635946

The Rabbit Polyclonal anti-SLC39A12 antibody (ABIN635946) specifically detects SLC39A12 in WB. The antibody is reactive with Human samples.

Quick Overview for SLC39A12 antibody (ABIN635946)

Target: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC39A12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC39A12 Antibody

Purification: Affinity purified

Immunogen: SLC39 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A12 Blocking Peptide, (ABIN5616246), is also available for use as a blocking control in assays to test for specificity of this SLC39A12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC39A12

Target: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Alternative Name: SLC39A12

Background: SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.

Molecular Weight: 73 kDa (MW of target protein)