SLC39A12 antibody

Catalog No. ABIN635946

Product Details anti-SLC39A12 Antibody

Target: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC39A12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC39 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A12 Blocking Peptide, catalog no. 33R-5811, is also available for use as a blocking control in assays to test for specificity of this SLC39A12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC39A12

Target: SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))

Alternative Name: SLC39A12 (SLC39A12 Products)

Synonyms: LZT-Hs8 antibody, ZIP-12 antibody, bA570F3.1 antibody, AW046938 antibody, Gm731 antibody, solute carrier family 39 member 12 antibody, solute carrier family 39 (zinc transporter), member 12 antibody, SLC39A12 antibody, Slc39a12 antibody, slc39a12 antibody

Background: SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.

Molecular Weight: 73 kDa (MW of target protein)