ST3GAL1 antibody (C-Term)

Catalog No. ABIN635955

The Rabbit Polyclonal anti-ST3GAL1 antibody (ABIN635955) specifically detects ST3GAL1 in WB. The antibody is reactive with Human and Rat samples.

Quick Overview for ST3GAL1 antibody (C-Term) (ABIN635955)

Target: ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST3GAL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ST3GAL1 Antibody

Binding Specificity: C-Term

Specificity: ST3 GAL1 antibody was raised against the C terminal of ST3 AL1

Purification: Affinity purified

Immunogen: ST3 GAL1 antibody was raised using the C terminal of ST3 AL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST3GAL1 Blocking Peptide, (ABIN936253), is also available for use as a blocking control in assays to test for specificity of this ST3GAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST3GAL1

Target: ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))

Alternative Name: ST3GAL1

Background: ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process