ST3GAL4 antibody (Middle Region)
Quick Overview for ST3GAL4 antibody (Middle Region) (ABIN635964)
Target
See all ST3GAL4 AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- Middle Region
-
Specificity
- ST3 GAL4 antibody was raised against the middle region of ST3 AL4
-
Purification
- Affinity purified
-
Immunogen
- ST3 GAL4 antibody was raised using the middle region of ST3 AL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV
-
-
-
-
Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
ST3GAL4 Blocking Peptide, (ABIN938255), is also available for use as a blocking control in assays to test for specificity of this ST3GAL4 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL4 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))
-
Alternative Name
- ST3GAL4
-
Background
- Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase, ST6GAL1.
-
Molecular Weight
- 37 kDa (MW of target protein)
-
Pathways
- Glycosaminoglycan Metabolic Process
Target
-