ICMT antibody (Middle Region)

Catalog No. ABIN635975

The Rabbit Polyclonal anti-ICMT antibody has been validated for WB. It is suitable to detect ICMT in samples from Human, Mouse and Rat.

Quick Overview for ICMT antibody (Middle Region) (ABIN635975)

Target: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICMT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ICMT Antibody

Binding Specificity: Middle Region

Specificity: ICMT antibody was raised against the middle region of ICMT

Purification: Affinity purified

Immunogen: ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ICMT Blocking Peptide, (ABIN938960), is also available for use as a blocking control in assays to test for specificity of this ICMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ICMT

Target: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Alternative Name: ICMT

Background: ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.

Molecular Weight: 32 kDa (MW of target protein)