ICMT antibody (Middle Region)

Catalog No. ABIN635975

Product Details anti-ICMT Antibody

Target: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICMT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ICMT antibody was raised against the middle region of ICMT

Purification: Affinity purified

Immunogen: ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ICMT Blocking Peptide, catalog no. 33R-3574, is also available for use as a blocking control in assays to test for specificity of this ICMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ICMT

Target: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Alternative Name: ICMT (ICMT Products)

Synonyms: HSTE14 antibody, MST098 antibody, MSTP098 antibody, PCCMT antibody, PCMT antibody, PPMT antibody, 1700008E11Rik antibody, C80758 antibody, Gm13095 antibody, OTTMUSG00000010406 antibody, STE14 antibody, pcCMT antibody, fcmt antibody, im:6895697 antibody, zgc:110258 antibody, isoprenylcysteine carboxyl methyltransferase antibody, cobalt-zinc-cadmium resistance protein antibody, Isoprenylcysteine carboxyl methyltransferase antibody, isoprenylcysteine carboxylmethyltransferase family protein antibody, isoprenylcysteine carboxyl methyltransferase S homeolog antibody, ICMT antibody, Icmt antibody, icmt antibody, Bcen_5417 antibody, Acid_0983 antibody, Bcenmc03_4825 antibody, RPIC_RS08670 antibody, Mesil_1887 antibody, Slip_1333 antibody, Deba_2487 antibody, Bresu_2161 antibody, MPET_RS04760 antibody, MPET_RS08305 antibody, Saut_0066 antibody, Intca_3523 antibody, Deima_2891 antibody, Despr_1203 antibody, Deipr_0831 antibody, Theth_0229 antibody, icmt.S antibody

Background: ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.

Molecular Weight: 32 kDa (MW of target protein)