A4GNT antibody (C-Term)
Quick Overview for A4GNT antibody (C-Term) (ABIN635982)
Target
See all A4GNT AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- C-Term
-
Specificity
- A4 GNT antibody was raised against the C terminal of A4 NT
-
Purification
- Affinity purified
-
Immunogen
- A4 GNT antibody was raised using the C terminal of A4 NT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
-
-
-
-
Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
A4GNT Blocking Peptide, (ABIN5611841), is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 NT antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))
-
Alternative Name
- A4GNT
-
Background
- A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.
-
Molecular Weight
- 39 kDa (MW of target protein)
Target
-