ARMCX3 antibody (Middle Region)

Catalog No. ABIN635988

The Rabbit Polyclonal anti-ARMCX3 antibody (ABIN635988) specifically detects ARMCX3 in WB. The antibody is reactive with Human samples.

Quick Overview for ARMCX3 antibody (Middle Region) (ABIN635988)

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARMCX3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARMCX3 Antibody

Binding Specificity: Middle Region

Specificity: ARMCX3 antibody was raised against the middle region of ARMCX3

Purification: Affinity purified

Immunogen: ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARMCX3 Blocking Peptide, (ABIN940334), is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARMCX3

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Alternative Name: ARMCX3

Background: ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.

Molecular Weight: 42 kDa (MW of target protein)