ARMCX3 antibody (Middle Region)

Catalog No. ABIN635988

Product Details anti-ARMCX3 Antibody

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARMCX3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARMCX3 antibody was raised against the middle region of ARMCX3

Purification: Affinity purified

Immunogen: ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARMCX3 Blocking Peptide, catalog no. 33R-4948, is also available for use as a blocking control in assays to test for specificity of this ARMCX3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARMCX3

Target: ARMCX3 (Armadillo Repeat Containing, X-Linked 3 (ARMCX3))

Alternative Name: ARMCX3 (ARMCX3 Products)

Synonyms: ALEX3 antibody, dJ545K15.2 antibody, 1200004E24Rik antibody, AI450003 antibody, ARMCX3 antibody, DKFZp459E2029 antibody, armadillo repeat containing, X-linked 3 antibody, ARMCX3 antibody, Armcx3 antibody

Background: ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.

Molecular Weight: 42 kDa (MW of target protein)