GALNT14 antibody

Catalog No. ABIN636010

This Rabbit Polyclonal antibody specifically detects GALNT14 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GALNT14 antibody (ABIN636010)

Target: GALNT14 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALNT14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GALNT14 Antibody

Purification: Affinity purified

Immunogen: GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNT14 Blocking Peptide, (ABIN940294), is also available for use as a blocking control in assays to test for specificity of this GALNT14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALNT14

Target: GALNT14 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14))

Alternative Name: GALNT14

Background: GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.

Molecular Weight: 64 kDa (MW of target protein)