UXS1 antibody (Middle Region)

Catalog No. ABIN636016

Product Details anti-UXS1 Antibody

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UXS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UXS1 antibody was raised against the middle region of UXS1

Purification: Affinity purified

Immunogen: UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UXS1 Blocking Peptide, catalog no. 33R-5205, is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UXS1

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Alternative Name: UXS1 (UXS1 Products)

Synonyms: SDR6E1 antibody, UGD antibody, 1600025I13Rik antibody, AI451869 antibody, AI649125 antibody, AW550562 antibody, CHUNP6891 antibody, fj36b08 antibody, wu:fj36b08 antibody, zgc:91980 antibody, UDP-glucuronate decarboxylase 1 antibody, uxs1 antibody, UXS1 antibody, Ccan_02290 antibody, Uxs1 antibody

Background: UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process