UXS1 antibody (Middle Region)

Catalog No. ABIN636016

This Rabbit Polyclonal antibody specifically detects UXS1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for UXS1 antibody (Middle Region) (ABIN636016)

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UXS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UXS1 Antibody

Binding Specificity: Middle Region

Specificity: UXS1 antibody was raised against the middle region of UXS1

Purification: Affinity purified

Immunogen: UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UXS1 Blocking Peptide, (ABIN5616942), is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UXS1

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Alternative Name: UXS1

Background: UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process