Aquaporin 10 antibody (C-Term)

Catalog No. ABIN636023

Product Details anti-Aquaporin 10 Antibody

Target: Aquaporin 10 (AQP10)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aquaporin 10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Aquaporin 10 antibody was raised against the C terminal of AQP10

Purification: Affinity purified

Immunogen: Aquaporin 10 antibody was raised using the C terminal of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Aquaporin 10 Blocking Peptide, catalog no. 33R-9546, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aquaporin 10

Target: Aquaporin 10 (AQP10)

Alternative Name: Aquaporin 10 (AQP10 Products)

Synonyms: aqp10 antibody, zgc:92167 antibody, AQP10 antibody, AQPA_HUMAN antibody, aquaporin 10a antibody, aquaporin 10 antibody, similar to aquaporin 10 antibody, aqp10a antibody, AQP10 antibody, LOC686596 antibody

Background: AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.

Molecular Weight: 32 kDa (MW of target protein)