GDE1 antibody (N-Term)

Catalog No. ABIN636050

The Rabbit Polyclonal anti-GDE1 antibody is suitable to detect GDE1 in samples from Human, Rat, Mouse and Dog. It has been validated for WB and IHC.

Quick Overview for GDE1 antibody (N-Term) (ABIN636050)

Target: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GDE1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-GDE1 Antibody

Binding Specificity: N-Term

Specificity: GDE1 antibody was raised against the N terminal Of Gde1

Purification: Affinity purified

Immunogen: GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GDE1 Blocking Peptide, (ABIN5613744), is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GDE1

Target: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Alternative Name: GDE1

Background: GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.

Molecular Weight: 38 kDa (MW of target protein)