CYP2D6 antibody (Middle Region)
-
- Target See all CYP2D6 Antibodies
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2D6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP2 D6 antibody was raised against the middle region of CYP2 6
- Purification
- Affinity purified
- Immunogen
- CYP2 D6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV
- Top Product
- Discover our top product CYP2D6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2D6 Blocking Peptide, catalog no. 33R-2258, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
- Alternative Name
- CYP2D6 (CYP2D6 Products)
- Background
- CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molecular Weight
- 56 kDa (MW of target protein)
-