HTRA4 antibody (Middle Region)

Catalog No. ABIN636082

Product Details anti-HTRA4 Antibody

Target: HTRA4 (HtrA Serine Peptidase 4 (HTRA4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HTRA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HTRA4 antibody was raised against the middle region of HTRA4

Purification: Affinity purified

Immunogen: HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HTRA4 Blocking Peptide, catalog no. 33R-5091, is also available for use as a blocking control in assays to test for specificity of this HTRA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTRA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HTRA4

Target: HTRA4 (HtrA Serine Peptidase 4 (HTRA4))

Alternative Name: HTRA4 (HTRA4 Products)

Synonyms: B430206E18Rik antibody, RGD1306242 antibody, HtrA serine peptidase 4 antibody, HTRA4 antibody, Htra4 antibody

Background: HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Molecular Weight: 51 kDa (MW of target protein)